SCOP 1.75: Domain d2j2jb1: 2j2j B:361-542

Lineage for d2j2jb1 (2j2j B:361-542)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (3 families)

5. Family b.21.1.1: Adenovirus fiber protein "knob" domain [49836] (1 protein)

6. Protein Adenovirus fiber protein "knob" domain [49837] (7 species)

7. Species Canine adenovirus 2 [TaxId:10514] [158981] (2 PDB entries)
   Uniprot Q65914 361-542

8. Domain d2j2jb1: 2j2j B:361-542 [147853]
   automatically matched to 2J1K C:361-542

Details for d2j2jb1

PDB Entry: 2j2j, 1.5 Å

PDB Description: canine adenovirus fibre head at 1.5 a resolution

PDB Compounds: (B:) fiber protein

SCOP Domain Sequences for d2j2jb1:

Sequence; same for both SEQRES and ATOM records:

>d2j2jb1 b.21.1.1 (B:361-542) Adenovirus fiber protein "knob" domain {Canine adenovirus 2 [TaxId: 10514]}
apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
nq

Timeline for d2j2jb1:

• d2j2jb1 is new in SCOP 1.75
  
• d2j2jb1 is called d2j2jb_ in SCOPe 2.01
  
• d2j2jb1 appears in the current release, SCOPe 2.08, called d2j2jb_