SCOPe 2.08: Domain d2j2ja_: 2j2j A:

Lineage for d2j2ja_ (2j2j A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.21: Virus attachment protein globular domain [49834] (1 superfamily)
   sandwich, 10 strands in 2 sheets; greek-key

4. Superfamily b.21.1: Virus attachment protein globular domain [49835] (4 families)

5. Family b.21.1.0: automated matches [191353] (1 protein)
   not a true family

6. Protein automated matches [190378] (9 species)
   not a true protein

7. Species Canine adenovirus 2 [TaxId:10514] [187225] (1 PDB entry)

8. Domain d2j2ja_: 2j2j A: [147852]
   automated match to d1p69a_

Details for d2j2ja_

PDB Entry: 2j2j, 1.5 Å

PDB Description: canine adenovirus fibre head at 1.5 a resolution

PDB Compounds: (A:) fiber protein

SCOPe Domain Sequences for d2j2ja_:

Sequence; same for both SEQRES and ATOM records:

>d2j2ja_ b.21.1.0 (A:) automated matches {Canine adenovirus 2 [TaxId: 10514]}
apitlwtgpgpsingfindtpvircficltrdsnlvtvnasfvgeggyrivsptqsqfsl
imefdqfgqlmstgninstttwgekpwgnntvqprpshtwklcmpnrevystpaatisrc
gldsiavdgapsrsidcmliinkpkgvatytltfrflnfnrlsggtlfktdvltftyvge
nq

Timeline for d2j2ja_:

• d2j2ja_ first appeared in SCOP 1.75, called d2j2ja1
  
• d2j2ja_ appears in SCOPe 2.07