![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.1: Ubiquitin-like [54236] (8 families) ![]() |
![]() | Family d.15.1.4: First domain of FERM [54256] (6 proteins) |
![]() | Protein Focal adhesion kinase 1 [142960] (1 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [142961] (3 PDB entries) Uniprot Q00944 31-130 |
![]() | Domain d2j0ma3: 2j0m A:31-130 [147847] Other proteins in same PDB: d2j0ma1, d2j0ma2 automatically matched to d2al6a3 complexed with 4st |
PDB Entry: 2j0m (more details), 2.8 Å
SCOP Domain Sequences for d2j0ma3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2j0ma3 d.15.1.4 (A:31-130) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]} gamervlkvfhyfenssepttwasiirhgdatdvrgiiqkivdchkvknvacyglrlshl qseevhwlhldmgvsnvrekfelahppeewkyelrirylp
Timeline for d2j0ma3: