Lineage for d2j0ma3 (2j0m A:31-130)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 853596Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 853597Superfamily d.15.1: Ubiquitin-like [54236] (8 families) (S)
  5. 853959Family d.15.1.4: First domain of FERM [54256] (6 proteins)
  6. 853969Protein Focal adhesion kinase 1 [142960] (1 species)
  7. 853970Species Chicken (Gallus gallus) [TaxId:9031] [142961] (3 PDB entries)
    Uniprot Q00944 31-130
  8. 853975Domain d2j0ma3: 2j0m A:31-130 [147847]
    Other proteins in same PDB: d2j0ma1, d2j0ma2
    automatically matched to d2al6a3
    complexed with 4st

Details for d2j0ma3

PDB Entry: 2j0m (more details), 2.8 Å

PDB Description: crystal structure a two-chain complex between the ferm and kinase domains of focal adhesion kinase.
PDB Compounds: (A:) Focal adhesion kinase 1

SCOP Domain Sequences for d2j0ma3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2j0ma3 d.15.1.4 (A:31-130) Focal adhesion kinase 1 {Chicken (Gallus gallus) [TaxId: 9031]}
gamervlkvfhyfenssepttwasiirhgdatdvrgiiqkivdchkvknvacyglrlshl
qseevhwlhldmgvsnvrekfelahppeewkyelrirylp

SCOP Domain Coordinates for d2j0ma3:

Click to download the PDB-style file with coordinates for d2j0ma3.
(The format of our PDB-style files is described here.)

Timeline for d2j0ma3: