SCOPe 2.08: Domain d2j0ma3: 2j0m A:31-130

Lineage for d2j0ma3 (2j0m A:31-130)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [254873] (2 PDB entries)

8. Domain d2j0ma3: 2j0m A:31-130 [147847]
   Other proteins in same PDB: d2j0ma1, d2j0ma2, d2j0mb_
   automated match to d2al6b3
   complexed with 4st

Details for d2j0ma3

PDB Entry: 2j0m, 2.8 Å

PDB Description: crystal structure a two-chain complex between the ferm and kinase domains of focal adhesion kinase.

PDB Compounds: (A:) Focal adhesion kinase 1

SCOPe Domain Sequences for d2j0ma3:

Sequence; same for both SEQRES and ATOM records:

>d2j0ma3 d.15.1.0 (A:31-130) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
gamervlkvfhyfenssepttwasiirhgdatdvrgiiqkivdchkvknvacyglrlshl
qseevhwlhldmgvsnvrekfelahppeewkyelrirylp

Timeline for d2j0ma3:

• d2j0ma3 first appeared in SCOP 1.75
  
• d2j0ma3 appears in SCOPe 2.07