Class b: All beta proteins [48724] (174 folds) |
Fold b.55: PH domain-like barrel [50728] (2 superfamilies) barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix |
Superfamily b.55.1: PH domain-like [50729] (14 families) |
Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins) |
Protein Enabled [50768] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [159215] (2 PDB entries) |
Domain d2iybb_: 2iyb B: [147837] automated match to d1evha_ complexed with zn |
PDB Entry: 2iyb (more details), 2.35 Å
SCOPe Domain Sequences for d2iybb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iybb_ b.55.1.4 (B:) Enabled {Human (Homo sapiens) [TaxId: 9606]} mseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvi ncaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevlns
Timeline for d2iybb_: