Lineage for d2iybb1 (2iyb B:2-112)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 805150Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 805151Superfamily b.55.1: PH domain-like [50729] (13 families) (S)
  5. 805481Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (6 proteins)
  6. 805489Protein Enabled [50768] (2 species)
  7. 805490Species Homo sapiens [TaxId:9606] [159215] (1 PDB entry)
  8. 805492Domain d2iybb1: 2iyb B:2-112 [147837]
    automatically matched to d1evha_
    complexed with zn

Details for d2iybb1

PDB Entry: 2iyb (more details), 2.35 Å

PDB Description: structure of complex between the 3rd lim domain of tes and the evh1 domain of mena
PDB Compounds: (B:) Protein enabled homolog

SCOP Domain Sequences for d2iybb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iybb1 b.55.1.4 (B:2-112) Enabled {Homo sapiens [TaxId: 9606]}
seqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvin
caipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevln

SCOP Domain Coordinates for d2iybb1:

Click to download the PDB-style file with coordinates for d2iybb1.
(The format of our PDB-style files is described here.)

Timeline for d2iybb1: