Lineage for d2iyba_ (2iyb A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2070980Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2070981Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2071370Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (7 proteins)
  6. 2071378Protein Enabled [50768] (2 species)
  7. 2071379Species Human (Homo sapiens) [TaxId:9606] [159215] (2 PDB entries)
  8. 2071380Domain d2iyba_: 2iyb A: [147836]
    automated match to d1evha_
    complexed with zn

Details for d2iyba_

PDB Entry: 2iyb (more details), 2.35 Å

PDB Description: structure of complex between the 3rd lim domain of tes and the evh1 domain of mena
PDB Compounds: (A:) Protein enabled homolog

SCOPe Domain Sequences for d2iyba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iyba_ b.55.1.4 (A:) Enabled {Human (Homo sapiens) [TaxId: 9606]}
rmseqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvv
incaipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevlns

SCOPe Domain Coordinates for d2iyba_:

Click to download the PDB-style file with coordinates for d2iyba_.
(The format of our PDB-style files is described here.)

Timeline for d2iyba_: