SCOP 1.75: Domain d2iyba1: 2iyb A:2-112

Lineage for d2iyba1 (2iyb A:2-112)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
   barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix

4. Superfamily b.55.1: PH domain-like [50729] (13 families)

5. Family b.55.1.4: Enabled/VASP homology 1 domain (EVH1 domain) [50767] (6 proteins)

6. Protein Enabled [50768] (2 species)

7. Species Homo sapiens [TaxId:9606] [159215] (1 PDB entry)

8. Domain d2iyba1: 2iyb A:2-112 [147836]
   automatically matched to d1evha_
   complexed with zn

Details for d2iyba1

PDB Entry: 2iyb, 2.35 Å

PDB Description: structure of complex between the 3rd lim domain of tes and the evh1 domain of mena

PDB Compounds: (A:) Protein enabled homolog

SCOP Domain Sequences for d2iyba1:

Sequence; same for both SEQRES and ATOM records:

>d2iyba1 b.55.1.4 (A:2-112) Enabled {Homo sapiens [TaxId: 9606]}
seqsicqaraavmvyddankkwvpaggstgfsrvhiyhhtgnntfrvvgrkiqdhqvvin
caipkglkynqatqtfhqwrdarqvyglnfgskedanvfasammhalevln

Timeline for d2iyba1:

• d2iyba1 is new in SCOP 1.75
  
• d2iyba1 is called d2iyba_ in SCOPe 2.01
  
• d2iyba1 appears in the current release, SCOPe 2.08, called d2iyba2