Lineage for d2ixva2 (2ixv A:2-190)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 814174Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 815285Superfamily c.1.8: (Trans)glycosidases [51445] (14 families) (S)
  5. 816722Family c.1.8.8: 1,4-beta-N-acetylmuraminidase [63912] (3 proteins)
    Glycosyl hydrolase family 25; probably have evolved from a type II chitinase ancestor
    permutation of the common fold; strand 8 is antiparallel to the rest of the barrel
  6. 816723Protein N-terminal domain of endolysin [89484] (1 species)
  7. 816724Species Bacteriophage cp-1 [TaxId:10747] [89485] (6 PDB entries)
  8. 816727Domain d2ixva2: 2ixv A:2-190 [147833]
    Other proteins in same PDB: d2ixva1
    automatically matched to d1h09a2
    complexed with fmt, mu2, nag; mutant

Details for d2ixva2

PDB Entry: 2ixv (more details), 1.96 Å

PDB Description: crystal structure of the modular cpl-1 endolysin complexed with a peptidoglycan analogue (e94q mutant)
PDB Compounds: (A:) lysozyme; synonym:cpl-1,endolysin,muramidase,cp-1 lysin

SCOP Domain Sequences for d2ixva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ixva2 c.1.8.8 (A:2-190) N-terminal domain of endolysin {Bacteriophage cp-1 [TaxId: 10747]}
vkkndlfvdvsshngyditgileqmgttntiikisesttylnpclsaqveqsnpigfyhf
arfggdvaeaereaqffldnvpmqvkylvldyqddpsgdaqantnaclrfmqmiadagyk
piyysykpfthdnvdyqqilaqfpnslwiagyglndgtanfeyfpsmdgirwwqyssnpf
dknivlldd

SCOP Domain Coordinates for d2ixva2:

Click to download the PDB-style file with coordinates for d2ixva2.
(The format of our PDB-style files is described here.)

Timeline for d2ixva2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ixva1