![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.109: beta-hairpin stack [69359] (1 superfamily) Trp-rich beta-hairpin repeat units form helical structures of 3 units per turn |
![]() | Superfamily b.109.1: Cell wall binding repeat [69360] (1 family) ![]() |
![]() | Family b.109.1.1: Cell wall binding repeat [69361] (4 proteins) this is a repeat family; one repeat unit is 2bib A:415-315 found in domain |
![]() | Protein automated matches [190222] (3 species) not a true protein |
![]() | Domain d2ixva1: 2ixv A:191-339 [147832] Other proteins in same PDB: d2ixva2 automated match to d2j8ga1 complexed with fmt, mu2, nag; mutant |
PDB Entry: 2ixv (more details), 1.96 Å
SCOPe Domain Sequences for d2ixva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ixva1 b.109.1.1 (A:191-339) automated matches {Streptococcus phage [TaxId: 10747]} eeddkpktagtwkqdskgwwfrrnngsfpynkwekiggvwyyfdskgycltsewlkdnek wyylkdngamatgwvlvgsewyymddsgamvtgwvkyknnwyymtnergnmvsnefiksg kgwyfmntngeladnpsftkepdglitva
Timeline for d2ixva1: