SCOP 1.75: Domain d2ixua2: 2ixu A:2-190

Lineage for d2ixua2 (2ixu A:2-190)

1. Root: SCOP 1.75

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.8: 1,4-beta-N-acetylmuraminidase [63912] (3 proteins)
   Glycosyl hydrolase family 25; probably have evolved from a type II chitinase ancestor
   permutation of the common fold; strand 8 is antiparallel to the rest of the barrel

6. Protein N-terminal domain of endolysin [89484] (1 species)

7. Species Bacteriophage cp-1 [TaxId:10747] [89485] (6 PDB entries)

8. Domain d2ixua2: 2ixu A:2-190 [147831]
   Other proteins in same PDB: d2ixua1
   automatically matched to d1h09a2
   complexed with fmt, mu2, nag

Details for d2ixua2

PDB Entry: 2ixu, 2.28 Å

PDB Description: crystal structure of the modular cpl-1 endolysin complexed with a peptidoglycan analogue (wild-type endolysin)

PDB Compounds: (A:) lysozyme

SCOP Domain Sequences for d2ixua2:

Sequence; same for both SEQRES and ATOM records:

>d2ixua2 c.1.8.8 (A:2-190) N-terminal domain of endolysin {Bacteriophage cp-1 [TaxId: 10747]}
vkkndlfvdvsshngyditgileqmgttntiikisesttylnpclsaqveqsnpigfyhf
arfggdvaeaereaqffldnvpmqvkylvldyeddpsgdaqantnaclrfmqmiadagyk
piyysykpfthdnvdyqqilaqfpnslwiagyglndgtanfeyfpsmdgirwwqyssnpf
dknivlldd

Timeline for d2ixua2:

• d2ixua2 is new in SCOP 1.75
  
• d2ixua2 appears in SCOPe 2.01
  
• d2ixua2 appears in the current release, SCOPe 2.08