SCOPe 2.08: Domain d2ixtb_: 2ixt B:

Lineage for d2ixtb_ (2ixt B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.41: Subtilisin-like [52742] (1 superfamily)
   3 layers: a/b/a, parallel beta-sheet of 7 strands, order 2314567; left-handed crossover connection between strands 2 & 3

4. Superfamily c.41.1: Subtilisin-like [52743] (3 families)

5. Family c.41.1.1: Subtilases [52744] (15 proteins)

6. Protein automated matches [190073] (16 species)
   not a true protein

7. Species Bacillus sphaericus [TaxId:1421] [188865] (2 PDB entries)

8. Domain d2ixtb_: 2ixt B: [147829]
   automated match to d1ea7a_
   complexed with ca

Details for d2ixtb_

PDB Entry: 2ixt, 0.8 Å

PDB Description: sphericase

PDB Compounds: (B:) 36kda protease

SCOPe Domain Sequences for d2ixtb_:

Sequence; same for both SEQRES and ATOM records:

>d2ixtb_ c.41.1.1 (B:) automated matches {Bacillus sphaericus [TaxId: 1421]}
rasqqipwgikaiynndtltsttggsginiavldtgvntshpdlvnnveqckdftgattp
innsctdrnghgthvagtaladggsdqagiygvapdadlwaykvlldsgsgysddiaaai
rhaadqatatgtktiismslgssannslissavnyayskgvlivaaagnsgysqgtigyp
galpnaiavaalenvqqngtyrvadyssrgyistagdyviqegdieisapgssvystwyn
ggyntisgtsmatphvsglaakiwaenpslsntqlrsnlqeraksvdikggygaaigddy
asgfgfarvq

Timeline for d2ixtb_:

• d2ixtb_ first appeared in SCOP 1.75, called d2ixtb1
  
• d2ixtb_ appears in SCOPe 2.07