![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.40: OB-fold [50198] (17 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) ![]() |
![]() | Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (36 proteins) barrel, closed; n=5, S=8 |
![]() | Protein Exoribonuclease 2, RNB, middle domain [418921] (1 species) RNase II; protein contains 3 S1-like domains in addition to an OB-fold embedded in the catalytic domain |
![]() | Species Escherichia coli [TaxId:562] [419349] (3 PDB entries) Uniprot P30850 |
![]() | Domain d2ix0a1: 2ix0 A:83-172 [147818] Other proteins in same PDB: d2ix0a2, d2ix0a3, d2ix0a4 complexed with c5p, ca, mg has additional insertions and/or extensions that are not grouped together |
PDB Entry: 2ix0 (more details), 2.44 Å
SCOPe Domain Sequences for d2ix0a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ix0a1 b.40.4.5 (A:83-172) Exoribonuclease 2, RNB, middle domain {Escherichia coli [TaxId: 562]} ltrfvgkvqgkndrlaivpdhpllkdaipcraarglnhefkegdwavaemrrhplkgdrs fyaeltqyitfgddhfvpwwvtlarhnlek
Timeline for d2ix0a1: