Class a: All alpha proteins [46456] (286 folds) |
Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
Superfamily a.74.1: Cyclin-like [47954] (4 families) duplication: consists of two domains of this fold |
Family a.74.1.1: Cyclin [47955] (9 proteins) |
Protein Cyclin-T2 [158593] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [158594] (1 PDB entry) Uniprot O60583 150-262! Uniprot O60583 7-149 |
Domain d2ivxb1: 2ivx B:9-149 [147815] automated match to d2ivxa1 complexed with edo |
PDB Entry: 2ivx (more details), 1.8 Å
SCOPe Domain Sequences for d2ivxb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ivxb1 a.74.1.1 (B:9-149) Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} srwfftreqlentpsrrcgveadkelscrqqaanliqemgqrlnvsqltintaivymhrf ymhhsftkfnkniisstalflaakveeqarklehvikvahaclhpleplldtkcdaylqq trelviletimlqtlgfeiti
Timeline for d2ivxb1: