Lineage for d2ivxb1 (2ivx B:9-149)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1091941Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 1091942Superfamily a.74.1: Cyclin-like [47954] (3 families) (S)
    duplication: consists of two domains of this fold
  5. 1091943Family a.74.1.1: Cyclin [47955] (8 proteins)
  6. 1092221Protein Cyclin-T2 [158593] (1 species)
  7. 1092222Species Human (Homo sapiens) [TaxId:9606] [158594] (1 PDB entry)
    Uniprot O60583 150-262! Uniprot O60583 7-149
  8. 1092225Domain d2ivxb1: 2ivx B:9-149 [147815]
    automatically matched to 2IVX A:7-149
    complexed with edo

Details for d2ivxb1

PDB Entry: 2ivx (more details), 1.8 Å

PDB Description: crystal structure of human cyclin t2 at 1.8 a resolution
PDB Compounds: (B:) cyclin-t2

SCOPe Domain Sequences for d2ivxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ivxb1 a.74.1.1 (B:9-149) Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]}
srwfftreqlentpsrrcgveadkelscrqqaanliqemgqrlnvsqltintaivymhrf
ymhhsftkfnkniisstalflaakveeqarklehvikvahaclhpleplldtkcdaylqq
trelviletimlqtlgfeiti

SCOPe Domain Coordinates for d2ivxb1:

Click to download the PDB-style file with coordinates for d2ivxb1.
(The format of our PDB-style files is described here.)

Timeline for d2ivxb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2ivxb2