SCOPe 2.01: Domain d2ivxa2: 2ivx A:150-262

Lineage for d2ivxa2 (2ivx A:150-262)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (3 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (8 proteins)

6. Protein Cyclin-T2 [158593] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [158594] (1 PDB entry)
   Uniprot O60583 150-262! Uniprot O60583 7-149

8. Domain d2ivxa2: 2ivx A:150-262 [147814]
   complexed with edo

Details for d2ivxa2

PDB Entry: 2ivx, 1.8 Å

PDB Description: crystal structure of human cyclin t2 at 1.8 a resolution

PDB Compounds: (A:) cyclin-t2

SCOPe Domain Sequences for d2ivxa2:

Sequence; same for both SEQRES and ATOM records:

>d2ivxa2 a.74.1.1 (A:150-262) Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]}
ehphtdvvkctqlvraskdlaqtsyfmatnslhlttfclqykptviacvcihlackwsnw
eipvstdgkhwweyvdptvtlelldeltheflqilektpnrlkkirnwranqa

Timeline for d2ivxa2:

• d2ivxa2 first appeared in SCOP 1.75
  
• d2ivxa2 appears in SCOPe 2.02
  
• d2ivxa2 appears in the current release, SCOPe 2.08