![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.74: Cyclin-like [47953] (1 superfamily) core: 5 helices; one helix is surrounded by the others |
![]() | Superfamily a.74.1: Cyclin-like [47954] (4 families) ![]() duplication: consists of two domains of this fold |
![]() | Family a.74.1.1: Cyclin [47955] (9 proteins) |
![]() | Protein Cyclin-T2 [158593] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [158594] (1 PDB entry) Uniprot O60583 150-262! Uniprot O60583 7-149 |
![]() | Domain d2ivxa1: 2ivx A:7-149 [147813] complexed with edo |
PDB Entry: 2ivx (more details), 1.8 Å
SCOPe Domain Sequences for d2ivxa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ivxa1 a.74.1.1 (A:7-149) Cyclin-T2 {Human (Homo sapiens) [TaxId: 9606]} assrwfftreqlentpsrrcgveadkelscrqqaanliqemgqrlnvsqltintaivymh rfymhhsftkfnkniisstalflaakveeqarklehvikvahaclhpleplldtkcdayl qqtrelviletimlqtlgfeiti
Timeline for d2ivxa1: