Lineage for d2iveb2 (2ive B:307-414)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1196365Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
    alpha+beta sandwich
  4. 1196366Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) (S)
    N-terminal domain is beta/beta/alpha common fold
  5. 1196567Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)
  6. 1196700Protein Protoporphyrinogen oxidase [102804] (2 species)
  7. 1196701Species Myxococcus xanthus [TaxId:34] [159952] (2 PDB entries)
    Uniprot P56601 307-414
  8. 1196705Domain d2iveb2: 2ive B:307-414 [147812]
    Other proteins in same PDB: d2ivea1, d2iveb1
    automatically matched to 2IVD A:307-414
    complexed with fad, gol, twn

Details for d2iveb2

PDB Entry: 2ive (more details), 2.7 Å

PDB Description: structure of protoporphyrinogen oxidase from myxococcus xanthus
PDB Compounds: (B:) protoporphyrinogen oxidase

SCOPe Domain Sequences for d2iveb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iveb2 d.16.1.5 (B:307-414) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]}
ayapiavvhlgfdagtlpapdgfgflvpaeeqrrmlgaihasttfpfraeggrvlyscmv
ggarqpglveqdedalaalareelkalagvtarpsftrvfrwplgipq

SCOPe Domain Coordinates for d2iveb2:

Click to download the PDB-style file with coordinates for d2iveb2.
(The format of our PDB-style files is described here.)

Timeline for d2iveb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iveb1