Lineage for d2iveb1 (2ive B:10-306,B:415-466)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2096453Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2096454Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2096508Family c.3.1.2: FAD-linked reductases, N-terminal domain [51913] (18 protein domains)
    C-terminal domain is alpha+beta is common for the family
  6. 2096793Protein Protoporphyrinogen oxidase [102183] (2 species)
  7. 2096794Species Myxococcus xanthus [TaxId:34] [159429] (2 PDB entries)
    Uniprot P56601 10-306,415-464
  8. 2096798Domain d2iveb1: 2ive B:10-306,B:415-466 [147811]
    Other proteins in same PDB: d2ivea2, d2iveb2
    automated match to d2ivda1
    complexed with fad, gol, twn

Details for d2iveb1

PDB Entry: 2ive (more details), 2.7 Å

PDB Description: structure of protoporphyrinogen oxidase from myxococcus xanthus
PDB Compounds: (B:) protoporphyrinogen oxidase

SCOPe Domain Sequences for d2iveb1:

Sequence, based on SEQRES records: (download)

>d2iveb1 c.3.1.2 (B:10-306,B:415-466) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]}
mnvavvgggisglavahhlrsrgtdavllessarlggavgthalagylveqgpnsfldre
patralaaalnlegriraadpaakrryvytrgrlrsvpasppaflasdilplgarlrvag
elfsrrapegvdeslaafgrrhlghratqvlldavqtgiyagdveqlsvaatfpmlvkme
rehrslilgairaqkaqrqaalpagtapklsgalstfdgglqvlidalaaslgdaahvga
rveglaredggwrliieehgrraelsvaqvvlaapahatakllrplddalaalvagiXyn
lghlervaaidaalqrlpglhlignaykgvglndcirnaaqladalvagn

Sequence, based on observed residues (ATOM records): (download)

>d2iveb1 c.3.1.2 (B:10-306,B:415-466) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]}
mnvavvgggisglavahhlrsrgtdavllessarlggavgthalagylveqgpnsfldre
patralaaalnlegriraadpaakrryvytrgrlrsvpasppaflasdilplgarlrvag
elfsrrapegvdeslaafgrrhlghratqvlldavqtgiyagdveqlsvaatfpmlvkme
rehrslilgairaqkaqrqapklsgalstfdgglqvlidalaaslgdaahvgarveglar
edggwrliieehgrraelsvaqvvlaapahatakllrplddalaalvagiXynlghlerv
aaidaalqrlpglhlignaykgvglndcirnaaqladalvagn

SCOPe Domain Coordinates for d2iveb1:

Click to download the PDB-style file with coordinates for d2iveb1.
(The format of our PDB-style files is described here.)

Timeline for d2iveb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2iveb2