Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) N-terminal domain is beta/beta/alpha common fold |
Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins) |
Protein Protoporphyrinogen oxidase [102804] (2 species) |
Species Myxococcus xanthus [TaxId:34] [159952] (2 PDB entries) Uniprot P56601 307-414 |
Domain d2ivea2: 2ive A:307-414 [147810] Other proteins in same PDB: d2ivea1, d2iveb1 automated match to d2ivda2 complexed with fad, gol, twn |
PDB Entry: 2ive (more details), 2.7 Å
SCOPe Domain Sequences for d2ivea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ivea2 d.16.1.5 (A:307-414) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} ayapiavvhlgfdagtlpapdgfgflvpaeeqrrmlgaihasttfpfraeggrvlyscmv ggarqpglveqdedalaalareelkalagvtarpsftrvfrwplgipq
Timeline for d2ivea2: