| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (7 families) ![]() N-terminal domain is beta/beta/alpha common fold |
| Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins) |
| Protein Protoporphyrinogen oxidase [102804] (2 species) |
| Species Myxococcus xanthus [TaxId:34] [159952] (2 PDB entries) Uniprot P56601 307-414 |
| Domain d2ivea2: 2ive A:307-414 [147810] Other proteins in same PDB: d2ivea1, d2iveb1 automatically matched to 2IVD A:307-414 complexed with fad, gol, twn |
PDB Entry: 2ive (more details), 2.7 Å
SCOP Domain Sequences for d2ivea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ivea2 d.16.1.5 (A:307-414) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]}
ayapiavvhlgfdagtlpapdgfgflvpaeeqrrmlgaihasttfpfraeggrvlyscmv
ggarqpglveqdedalaalareelkalagvtarpsftrvfrwplgipq
Timeline for d2ivea2: