![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily) alpha+beta sandwich |
![]() | Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families) ![]() N-terminal domain is beta/beta/alpha common fold |
![]() | Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins) |
![]() | Protein Protoporphyrinogen oxidase [102804] (2 species) |
![]() | Species Myxococcus xanthus [TaxId:34] [159952] (2 PDB entries) Uniprot P56601 307-414 |
![]() | Domain d2ivdb2: 2ivd B:307-414 [147808] Other proteins in same PDB: d2ivda1, d2ivdb1 automated match to d2ivda2 complexed with acj, fad, gol, twn |
PDB Entry: 2ivd (more details), 2.3 Å
SCOPe Domain Sequences for d2ivdb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ivdb2 d.16.1.5 (B:307-414) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} ayapiavvhlgfdagtlpapdgfgflvpaeeqrrmlgaihasttfpfraeggrvlyscmv ggarqpglveqdedalaalareelkalagvtarpsftrvfrwplgipq
Timeline for d2ivdb2: