SCOPe 2.08: Domain d2ivdb2: 2ivd B:307-414

Lineage for d2ivdb2 (2ivd B:307-414)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.16: FAD-linked reductases, C-terminal domain [54372] (1 superfamily)
   alpha+beta sandwich

4. Superfamily d.16.1: FAD-linked reductases, C-terminal domain [54373] (8 families)
   N-terminal domain is beta/beta/alpha common fold

5. Family d.16.1.5: L-aminoacid/polyamine oxidase [54394] (6 proteins)

6. Protein Protoporphyrinogen oxidase [102804] (2 species)

7. Species Myxococcus xanthus [TaxId:34] [159952] (2 PDB entries)
   Uniprot P56601 307-414

8. Domain d2ivdb2: 2ivd B:307-414 [147808]
   Other proteins in same PDB: d2ivda1, d2ivdb1
   automated match to d2ivda2
   complexed with acj, fad, gol, twn

Details for d2ivdb2

PDB Entry: 2ivd, 2.3 Å

PDB Description: structure of protoporphyrinogen oxidase from myxococcus xanthus with acifluorfen

PDB Compounds: (B:) protoporphyrinogen oxidase

SCOPe Domain Sequences for d2ivdb2:

Sequence; same for both SEQRES and ATOM records:

>d2ivdb2 d.16.1.5 (B:307-414) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]}
ayapiavvhlgfdagtlpapdgfgflvpaeeqrrmlgaihasttfpfraeggrvlyscmv
ggarqpglveqdedalaalareelkalagvtarpsftrvfrwplgipq

Timeline for d2ivdb2:

• d2ivdb2 first appeared in SCOP 1.75
  
• d2ivdb2 appears in SCOPe 2.07