![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins) |
![]() | Protein Transcriptional activator DhaS [158248] (1 species) |
![]() | Species Lactococcus lactis [TaxId:1358] [158249] (1 PDB entry) Uniprot Q9CIV9 8-78 |
![]() | Domain d2iu5a1: 2iu5 A:1-71 [147801] Other proteins in same PDB: d2iu5a2, d2iu5b2, d2iu5b3 |
PDB Entry: 2iu5 (more details), 1.6 Å
SCOPe Domain Sequences for d2iu5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2iu5a1 a.4.1.9 (A:1-71) Transcriptional activator DhaS {Lactococcus lactis [TaxId: 1358]} meksiitqkiiakafkdlmqsnayhqisvsdimqtakirrqtfynyfqnqeellswifen dfaelindnsd
Timeline for d2iu5a1: