Lineage for d2itfd_ (2itf D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766795Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. 2766796Family b.1.28.1: NEAT domain [158912] (4 proteins)
    Pfam PF05031; iron transport-associated domain
  6. 2766797Protein Iron-regulated surface determinant protein A, IsdA [158915] (1 species)
  7. 2766798Species Staphylococcus aureus [TaxId:1280] [158916] (3 PDB entries)
    Uniprot Q7A152 64-184! Uniprot Q99UX4 63-184
  8. 2766805Domain d2itfd_: 2itf D: [147800]
    automated match to d2o1aa1
    complexed with hem

Details for d2itfd_

PDB Entry: 2itf (more details), 1.9 Å

PDB Description: crystal structure isda neat domain from staphylococcus aureus with heme bound
PDB Compounds: (D:) Iron-regulated surface determinant protein A

SCOPe Domain Sequences for d2itfd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2itfd_ b.1.28.1 (D:) Iron-regulated surface determinant protein A, IsdA {Staphylococcus aureus [TaxId: 1280]}
sqatsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeykfyna
nnqelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefekaip
tla

SCOPe Domain Coordinates for d2itfd_:

Click to download the PDB-style file with coordinates for d2itfd_.
(The format of our PDB-style files is described here.)

Timeline for d2itfd_: