SCOPe 2.06: Domain d2itfc_: 2itf C:

Lineage for d2itfc_ (2itf C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.28: NEAT domain-like [158911] (2 families)

5. Family b.1.28.1: NEAT domain [158912] (4 proteins)
   Pfam PF05031; iron transport-associated domain

6. Protein Iron-regulated surface determinant protein A, IsdA [158915] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [158916] (3 PDB entries)
   Uniprot Q7A152 64-184! Uniprot Q99UX4 63-184

8. Domain d2itfc_: 2itf C: [147799]
   automated match to d2o1aa1
   complexed with hem

Details for d2itfc_

PDB Entry: 2itf, 1.9 Å

PDB Description: crystal structure isda neat domain from staphylococcus aureus with heme bound

PDB Compounds: (C:) Iron-regulated surface determinant protein A

SCOPe Domain Sequences for d2itfc_:

Sequence; same for both SEQRES and ATOM records:

>d2itfc_ b.1.28.1 (C:) Iron-regulated surface determinant protein A, IsdA {Staphylococcus aureus [TaxId: 1280]}
atsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeykfynann
qelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefekaiptl
a

Timeline for d2itfc_:

• d2itfc_ first appeared in SCOP 1.75, called d2itfc1
  
• d2itfc_ appears in SCOPe 2.05
  
• d2itfc_ appears in SCOPe 2.07
  
• d2itfc_ appears in the current release, SCOPe 2.08