![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.28: NEAT domain-like [158911] (1 family) ![]() |
![]() | Family b.1.28.1: NEAT domain [158912] (3 proteins) Pfam PF05031; iron transport-associated domain |
![]() | Protein Iron-regulated surface determinant protein A, IsdA [158915] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [158916] (3 PDB entries) Uniprot Q7A152 64-184! Uniprot Q99UX4 63-184 |
![]() | Domain d2itfb1: 2itf B:64-184 [147798] automatically matched to 2ITE A:64-184 complexed with hem |
PDB Entry: 2itf (more details), 1.9 Å
SCOP Domain Sequences for d2itfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2itfb1 b.1.28.1 (B:64-184) Iron-regulated surface determinant protein A, IsdA {Staphylococcus aureus [TaxId: 1280]} atsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeykfynann qelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefekaiptl a
Timeline for d2itfb1: