Lineage for d2itfb_ (2itf B:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. Superfamily b.1.28: NEAT domain-like [158911] (2 families) (S)
  5. Family b.1.28.1: NEAT domain [158912] (4 proteins)
    Pfam PF05031; iron transport-associated domain
  6. Protein Iron-regulated surface determinant protein A, IsdA [158915] (1 species)
  7. Species Staphylococcus aureus [TaxId:1280] [158916] (3 PDB entries)
    Uniprot Q7A152 64-184! Uniprot Q99UX4 63-184
  8. Domain d2itfb_: 2itf B: [147798]
    automated match to d2o1aa1
    complexed with hem

Details for d2itfb_

PDB Entry: 2itf (more details), 1.9 Å

PDB Description: crystal structure isda neat domain from staphylococcus aureus with heme bound
PDB Compounds: (B:) Iron-regulated surface determinant protein A

SCOPe Domain Sequences for d2itfb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2itfb_ b.1.28.1 (B:) Iron-regulated surface determinant protein A, IsdA {Staphylococcus aureus [TaxId: 1280]}
atsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeykfynann
qelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefekaiptl
a

SCOPe Domain Coordinates for d2itfb_ are not available.

Timeline for d2itfb_:

Domains from other chains:
(mouse over for more information)
d2itfa_, d2itfc_, d2itfd_