Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.28: NEAT domain-like [158911] (2 families) |
Family b.1.28.1: NEAT domain [158912] (4 proteins) Pfam PF05031; iron transport-associated domain |
Protein Iron-regulated surface determinant protein A, IsdA [158915] (1 species) |
Species Staphylococcus aureus [TaxId:1280] [158916] (3 PDB entries) Uniprot Q7A152 64-184! Uniprot Q99UX4 63-184 |
Domain d2itfa_: 2itf A: [147797] automated match to d2o1aa1 complexed with hem |
PDB Entry: 2itf (more details), 1.9 Å
SCOPe Domain Sequences for d2itfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2itfa_ b.1.28.1 (A:) Iron-regulated surface determinant protein A, IsdA {Staphylococcus aureus [TaxId: 1280]} atsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeykfynann qelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefekaiptl a
Timeline for d2itfa_: