SCOP 1.75: Domain d2iteb1: 2ite B:64-184

Lineage for d2iteb1 (2ite B:64-184)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.28: NEAT domain-like [158911] (1 family)

5. Family b.1.28.1: NEAT domain [158912] (3 proteins)
   Pfam PF05031; iron transport-associated domain

6. Protein Iron-regulated surface determinant protein A, IsdA [158915] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [158916] (3 PDB entries)
   Uniprot Q7A152 64-184! Uniprot Q99UX4 63-184

8. Domain d2iteb1: 2ite B:64-184 [147796]
   automatically matched to 2ITE A:64-184
   complexed with nhe

Details for d2iteb1

PDB Entry: 2ite, 1.6 Å

PDB Description: crystal structure of the isda neat domain from staphylococcus aureus

PDB Compounds: (B:) Iron-regulated surface determinant protein A

SCOP Domain Sequences for d2iteb1:

Sequence; same for both SEQRES and ATOM records:

>d2iteb1 b.1.28.1 (B:64-184) Iron-regulated surface determinant protein A, IsdA {Staphylococcus aureus [TaxId: 1280]}
atsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeykfynann
qelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefekaiptl
a

Timeline for d2iteb1:

• d2iteb1 is new in SCOP 1.75
  
• d2iteb1 is called d2iteb_ in SCOPe 2.01
  
• d2iteb1 appears in the current release, SCOPe 2.08, called d2iteb_