SCOPe 2.08: Domain d2itea1: 2ite A:64-184

Lineage for d2itea1 (2ite A:64-184)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.28: NEAT domain-like [158911] (2 families)

5. Family b.1.28.1: NEAT domain [158912] (4 proteins)
   Pfam PF05031; iron transport-associated domain

6. Protein Iron-regulated surface determinant protein A, IsdA [158915] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [158916] (3 PDB entries)
   Uniprot Q7A152 64-184! Uniprot Q99UX4 63-184

8. Domain d2itea1: 2ite A:64-184 [147795]
   complexed with nhe

Details for d2itea1

PDB Entry: 2ite, 1.6 Å

PDB Description: crystal structure of the isda neat domain from staphylococcus aureus

PDB Compounds: (A:) Iron-regulated surface determinant protein A

SCOPe Domain Sequences for d2itea1:

Sequence; same for both SEQRES and ATOM records:

>d2itea1 b.1.28.1 (A:64-184) Iron-regulated surface determinant protein A, IsdA {Staphylococcus aureus [TaxId: 1280]}
atsqpinfqvqkdgssekshmddymqhpgkvikqnnkyyfqtvlnnasfwkeykfynann
qelattvvndnkkadtrtinvavepgykslttkvhivvpqinynhrytthlefekaiptl
a

Timeline for d2itea1:

• d2itea1 first appeared in SCOP 1.75
  
• d2itea1 appears in SCOPe 2.07