Lineage for d2itbb_ (2itb B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703875Family a.25.1.7: MiaE-like [158405] (1 protein)
    Pfam PF06175; tRNA-(MS[2]IO[6]A)-hydroxylase (MiaE)
  6. 2703876Protein Putative tRNA-(Ms(2)io(6)a)-hydroxylase PP2188 [158406] (1 species)
  7. 2703877Species Pseudomonas putida [TaxId:303] [158407] (4 PDB entries)
    Uniprot Q88KV1 3-201
  8. 2703883Domain d2itbb_: 2itb B: [147794]
    automated match to d2itba1
    complexed with edo, fe, per, unl

Details for d2itbb_

PDB Entry: 2itb (more details), 2.05 Å

PDB Description: crystal structure of a putative trna-(ms(2)io(6)a)-hydroxylase (pp_2188) from pseudomonas putida kt2440 at 2.05 a resolution
PDB Compounds: (B:) TRNA-(Ms(2)io(6)a)-hydroxylase, putative

SCOPe Domain Sequences for d2itbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2itbb_ a.25.1.7 (B:) Putative tRNA-(Ms(2)io(6)a)-hydroxylase PP2188 {Pseudomonas putida [TaxId: 303]}
ipeidaflgcptpdawieaaladqetllidhkncefkaastalsliakynthldlinmms
rlareelvhheqvlrlmkrrgvplrpvsagryasglrrlvrahepvklvdtlvvgafiea
rscerfaalvphldeelgrfyhgllksearhyqgylklahnygdeadiarcvelvraaem
eliqspdqelrfhsgipq

SCOPe Domain Coordinates for d2itbb_:

Click to download the PDB-style file with coordinates for d2itbb_.
(The format of our PDB-style files is described here.)

Timeline for d2itbb_: