SCOPe 2.08: Domain d2itbb_: 2itb B:

Lineage for d2itbb_ (2itb B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.7: MiaE-like [158405] (1 protein)
   Pfam PF06175; tRNA-(MS[2]IO[6]A)-hydroxylase (MiaE)

6. Protein Putative tRNA-(Ms(2)io(6)a)-hydroxylase PP2188 [158406] (1 species)

7. Species Pseudomonas putida [TaxId:303] [158407] (4 PDB entries)
   Uniprot Q88KV1 3-201

8. Domain d2itbb_: 2itb B: [147794]
   automated match to d2itba1
   complexed with edo, fe, per, unl

Details for d2itbb_

PDB Entry: 2itb, 2.05 Å

PDB Description: crystal structure of a putative trna-(ms(2)io(6)a)-hydroxylase (pp_2188) from pseudomonas putida kt2440 at 2.05 a resolution

PDB Compounds: (B:) TRNA-(Ms(2)io(6)a)-hydroxylase, putative

SCOPe Domain Sequences for d2itbb_:

Sequence; same for both SEQRES and ATOM records:

>d2itbb_ a.25.1.7 (B:) Putative tRNA-(Ms(2)io(6)a)-hydroxylase PP2188 {Pseudomonas putida [TaxId: 303]}
ipeidaflgcptpdawieaaladqetllidhkncefkaastalsliakynthldlinmms
rlareelvhheqvlrlmkrrgvplrpvsagryasglrrlvrahepvklvdtlvvgafiea
rscerfaalvphldeelgrfyhgllksearhyqgylklahnygdeadiarcvelvraaem
eliqspdqelrfhsgipq

Timeline for d2itbb_:

• d2itbb_ first appeared in SCOP 1.75, called d2itbb1
  
• d2itbb_ appears in SCOPe 2.07