Lineage for d2itba1 (2itb A:3-201)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 910725Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 910726Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 912093Family a.25.1.7: MiaE-like [158405] (1 protein)
    Pfam PF06175; tRNA-(MS[2]IO[6]A)-hydroxylase (MiaE)
  6. 912094Protein Putative tRNA-(Ms(2)io(6)a)-hydroxylase PP2188 [158406] (1 species)
  7. 912095Species Pseudomonas putida [TaxId:303] [158407] (1 PDB entry)
    Uniprot Q88KV1 3-201
  8. 912096Domain d2itba1: 2itb A:3-201 [147793]
    complexed with edo, fe, per, unl

Details for d2itba1

PDB Entry: 2itb (more details), 2.05 Å

PDB Description: crystal structure of a putative trna-(ms(2)io(6)a)-hydroxylase (pp_2188) from pseudomonas putida kt2440 at 2.05 a resolution
PDB Compounds: (A:) TRNA-(Ms(2)io(6)a)-hydroxylase, putative

SCOPe Domain Sequences for d2itba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2itba1 a.25.1.7 (A:3-201) Putative tRNA-(Ms(2)io(6)a)-hydroxylase PP2188 {Pseudomonas putida [TaxId: 303]}
lipeidaflgcptpdawieaaladqetllidhkncefkaastalsliakynthldlinmm
srlareelvhheqvlrlmkrrgvplrpvsagryasglrrlvrahepvklvdtlvvgafie
arscerfaalvphldeelgrfyhgllksearhyqgylklahnygdeadiarcvelvraae
meliqspdqelrfhsgipq

SCOPe Domain Coordinates for d2itba1:

Click to download the PDB-style file with coordinates for d2itba1.
(The format of our PDB-style files is described here.)

Timeline for d2itba1: