Lineage for d2iqig_ (2iqi G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2882247Superfamily c.51.6: XCC0632-like [159594] (2 families) (S)
    short crossover loop between strands 2 and 3; the antiparallel part of the beta-sheet (strands 3, 4 and 5) and the C-terminal helix are quite long
  5. 2882252Family c.51.6.2: XCC0632-like [159598] (1 protein)
    Pfam PF03886; DUF330
  6. 2882253Protein Hypothetical protein XCC0632 [159599] (1 species)
  7. 2882254Species Xanthomonas campestris pv. campestris [TaxId:340] [159600] (1 PDB entry)
    Uniprot Q8PCT0 32-209
  8. 2882261Domain d2iqig_: 2iqi G: [147783]
    automated match to d2iqia1

Details for d2iqig_

PDB Entry: 2iqi (more details), 2.7 Å

PDB Description: crystal structure of protein xcc0632 from xanthomonas campestris, pfam duf330
PDB Compounds: (G:) Hypothetical protein XCC0632

SCOPe Domain Sequences for d2iqig_:

Sequence, based on SEQRES records: (download)

>d2iqig_ c.51.6.2 (G:) Hypothetical protein XCC0632 {Xanthomonas campestris pv. campestris [TaxId: 340]}
tiyaptvrvtpnpawpqvswqllvakpsaariidsprinvrptpgelqvyhgagwaqpat
dmledsvvrafedsgkiaavarigagirsdyklaidvrrfesdyagqslpaatielnakl
lhssdqrvvasrtftvarpssstdtaavaaafeqaltqvttelvgwtlitgqqdsqt

Sequence, based on observed residues (ATOM records): (download)

>d2iqig_ c.51.6.2 (G:) Hypothetical protein XCC0632 {Xanthomonas campestris pv. campestris [TaxId: 340]}
tiyaptvrvtpnpawpqvswqllvakpsaariidsprinvrptpgelqvyhgagwaqpat
dmledsvvrafedsgkiaavarisdyklaidvrrfesdyagqslpaatielnakllhssd
qrvvasrtftvarpssstdtaavaaafeqaltqvttelvgwtlitgqqdsqt

SCOPe Domain Coordinates for d2iqig_:

Click to download the PDB-style file with coordinates for d2iqig_.
(The format of our PDB-style files is described here.)

Timeline for d2iqig_: