Lineage for d2iqha1 (2iqh A:21-489)

  1. Root: SCOPe 2.07
  2. 2618030Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2626355Fold e.75: Flu NP-like [161002] (1 superfamily)
    consists of alpha+beta and all-alpha domains; biological unit is a trimer
  4. 2626356Superfamily e.75.1: flu NP-like [161003] (1 family) (S)
    automatically mapped to Pfam PF00506
  5. 2626357Family e.75.1.1: Flu NP-like [161004] (2 proteins)
    Pfam PF00506; Influenza virus nucleoprotein
  6. 2626358Protein Nucleocapsid protein [161005] (1 species)
  7. 2626359Species Influenza A virus, different strains [TaxId:11320] [161006] (11 PDB entries)
    Uniprot Q1I2B5 21-489
  8. 2626387Domain d2iqha1: 2iqh A:21-489 [147774]

Details for d2iqha1

PDB Entry: 2iqh (more details), 3.2 Å

PDB Description: Influenza A virus nucleoprotein NP at 3.2A resolution
PDB Compounds: (A:) nucleocapsid protein

SCOPe Domain Sequences for d2iqha1:

Sequence, based on SEQRES records: (download)

>d2iqha1 e.75.1.1 (A:21-489) Nucleocapsid protein {Influenza A virus, different strains [TaxId: 11320]}
nateirasvgkmidgigrfyiqmctelklsdyegrliqnsltiermvlsafderrnkyle
ehpsagkdpkktggpiyrrvdgkwrrelilydkeeirriwrqanngddataglthmmiwh
snlndatyqrtralvrtgmdprmcslmqgstlprrsgaagaavkgvgtmvmelirmikrg
indrnfwrgengrrtriayermcnilkgkfqtaaqrtmvdqvresrnpgnaefedlifla
rsalilrgsvahksclpacvygsavasgydferegyslvgidpfrllqnsqvyslirpne
npahksqlvwmachsaafedlrvssfirgtkvvprgklstrgvqiasnenmetmesstle
lrsrywairtrsggntnqqrassgqisiqptfsvqrnlpfdrptimaaftgntegrtsdm
rteiirlmesarpedvsfqgrgvfelsdekatspivpsfdmsnegsyff

Sequence, based on observed residues (ATOM records): (download)

>d2iqha1 e.75.1.1 (A:21-489) Nucleocapsid protein {Influenza A virus, different strains [TaxId: 11320]}
nateirasvgkmidgigrfyiqmctelklsdyegrliqnsltiermvlsafdtggpiyrr
vdgkwrrelilydkeeirriwrqanngddataglthmmiwhsnlndatyqrtralvrtgm
dprmcslmqgstlprrsgaagaavkgvgtmvmelirmikrginrrtriayermcnilkgk
fqtaaqrtmvdqvresrnpgnaefedliflarsalilrgsvahksclpacvygsavasgy
dferegyslvgidpfrllqnsqvyslirpnenpahksqlvwmachsaafedlrvssfirg
tkvvprgklstrgvqiasnenmetmesstlelrsrywairtrsggntssgqisiqptfsv
qrnlpfdrptimaasdmrteiirlmesarpedvsfqgrgvfelsdekatspivpsfdmsn
egsyff

SCOPe Domain Coordinates for d2iqha1:

Click to download the PDB-style file with coordinates for d2iqha1.
(The format of our PDB-style files is described here.)

Timeline for d2iqha1: