![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) ![]() contains a small beta-sheet (wing) |
![]() | Family a.4.5.74: STY4665 C-terminal domain-like [158308] (1 protein) Pfam PF07515; DUF1528; the "wing" hairpin, linker between helices 1 and 2 and the C-terminal tail together form an open beta-sheet barrel |
![]() | Protein Hypothetical protein STY4665 [158309] (1 species) |
![]() | Species Salmonella typhi [TaxId:90370] [158310] (1 PDB entry) Uniprot Q8Z1C5 396-528 |
![]() | Domain d2ipqx1: 2ipq X:396-528 [147770] |
PDB Entry: 2ipq (more details), 2.2 Å
SCOPe Domain Sequences for d2ipqx1:
Sequence, based on SEQRES records: (download)
>d2ipqx1 a.4.5.74 (X:396-528) Hypothetical protein STY4665 {Salmonella typhi [TaxId: 90370]} lsstelgdlfwswlrdglregdipvntadacvhltcgfvfisvpgvfflflkshsrscss glkesgrkeqvqaafekmrkhrvsdsrrfwqcclyeepggrgrykkltgylikmseiyan gnfpddslflkvi
>d2ipqx1 a.4.5.74 (X:396-528) Hypothetical protein STY4665 {Salmonella typhi [TaxId: 90370]} lsstelgdlfwswlrdglregdipvntadacvhltcgfvfisvpgvfflflkshgrkeqv qaafekmrkhrvsdsrrfwqcclyeepggrgrykkltgylikmseiyngnfpddslflkv i
Timeline for d2ipqx1: