Lineage for d2ipqx1 (2ipq X:396-528)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2694441Family a.4.5.74: STY4665 C-terminal domain-like [158308] (1 protein)
    Pfam PF07515; DUF1528; the "wing" hairpin, linker between helices 1 and 2 and the C-terminal tail together form an open beta-sheet barrel
  6. 2694442Protein Hypothetical protein STY4665 [158309] (1 species)
  7. 2694443Species Salmonella typhi [TaxId:90370] [158310] (1 PDB entry)
    Uniprot Q8Z1C5 396-528
  8. 2694444Domain d2ipqx1: 2ipq X:396-528 [147770]

Details for d2ipqx1

PDB Entry: 2ipq (more details), 2.2 Å

PDB Description: crystal structure of c-terminal domain of salmonella enterica protein sty4665, pfam duf1528
PDB Compounds: (X:) Hypothetical protein STY4665

SCOPe Domain Sequences for d2ipqx1:

Sequence, based on SEQRES records: (download)

>d2ipqx1 a.4.5.74 (X:396-528) Hypothetical protein STY4665 {Salmonella typhi [TaxId: 90370]}
lsstelgdlfwswlrdglregdipvntadacvhltcgfvfisvpgvfflflkshsrscss
glkesgrkeqvqaafekmrkhrvsdsrrfwqcclyeepggrgrykkltgylikmseiyan
gnfpddslflkvi

Sequence, based on observed residues (ATOM records): (download)

>d2ipqx1 a.4.5.74 (X:396-528) Hypothetical protein STY4665 {Salmonella typhi [TaxId: 90370]}
lsstelgdlfwswlrdglregdipvntadacvhltcgfvfisvpgvfflflkshgrkeqv
qaafekmrkhrvsdsrrfwqcclyeepggrgrykkltgylikmseiyngnfpddslflkv
i

SCOPe Domain Coordinates for d2ipqx1:

Click to download the PDB-style file with coordinates for d2ipqx1.
(The format of our PDB-style files is described here.)

Timeline for d2ipqx1: