Lineage for d2ipoa1 (2ipo A:1-150)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 844055Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 844056Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (1 family) (S)
  5. 844057Family c.78.1.1: Aspartate/ornithine carbamoyltransferase [53672] (3 proteins)
  6. 844058Protein Aspartate carbamoyltransferase catalytic subunit [53673] (4 species)
  7. 844074Species Escherichia coli [TaxId:562] [53674] (50 PDB entries)
    Uniprot P00479
  8. 844149Domain d2ipoa1: 2ipo A:1-150 [147762]
    Other proteins in same PDB: d2ipob1, d2ipob2, d2ipod1, d2ipod2
    automatically matched to d1ekxa1
    complexed with 1ip, mae, mpd, zn

Details for d2ipoa1

PDB Entry: 2ipo (more details), 2.6 Å

PDB Description: E. coli Aspartate Transcarbamoylase complexed with N-phosphonacetyl-L-asparagine
PDB Compounds: (A:) Aspartate carbamoyltransferase catalytic chain

SCOP Domain Sequences for d2ipoa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ipoa1 c.78.1.1 (A:1-150) Aspartate carbamoyltransferase catalytic subunit {Escherichia coli [TaxId: 562]}
anplyqkhiisindlsrddlnlvlataaklkanpqpellkhkviascffeastrtrlsfe
tsmhrlgasvvgfsdsantslgkkgetladtisvistyvdaivmrhpqegaarlatefsg
nvpvlnagdgsnqhptqtlldlftiqetqg

SCOP Domain Coordinates for d2ipoa1:

Click to download the PDB-style file with coordinates for d2ipoa1.
(The format of our PDB-style files is described here.)

Timeline for d2ipoa1: