SCOPe 2.08: Domain d2ioue2: 2iou E:171-380

Lineage for d2ioue2 (2iou E:171-380)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.169: C-type lectin-like [56435] (1 superfamily)
   unusual fold

4. Superfamily d.169.1: C-type lectin-like [56436] (9 families)

5. Family d.169.1.8: Mtd variable domain [143964] (1 protein)
   fold decorated with many additional structures; overall similarity to the Sulfatase modifying factor family; lacks the characteristic disulfide

6. Protein Major tropism determinant (Mtd), C-terminal domain [143965] (1 species)

7. Species Bordetella phage bpp-1 [TaxId:194699] [143966] (6 PDB entries)
   Uniprot Q775D6 171-380
   includes related Bordetella phage proteins

8. Domain d2ioue2: 2iou E:171-380 [147759]
   Other proteins in same PDB: d2ioua1, d2ioub1, d2iouc1, d2ioud1, d2ioue1, d2iouf1, d2ioug_, d2iouh_
   automated match to d1yu2a2
   complexed with mg

Details for d2ioue2

PDB Entry: 2iou, 3.16 Å

PDB Description: major tropism determinant p1 (mtd-p1) variant complexed with bordetella brochiseptica virulence factor pertactin extracellular domain (prn-e).

PDB Compounds: (E:) Major Tropism Determinant P1

SCOPe Domain Sequences for d2ioue2:

Sequence; same for both SEQRES and ATOM records:

>d2ioue2 d.169.1.8 (E:171-380) Major tropism determinant (Mtd), C-terminal domain {Bordetella phage bpp-1 [TaxId: 194699]}
kfrpaaldprgmtlvagafwadiyllgvnhltdgtskynvtiadgsaspkkstkfggdgs
aaysdgawynfaevmthhgkrlpnynefqalafgtteatssggtdvpttgvngtgatsaw
niftskwgvvqasgclwtwgnefggvngaseytantggrgsvyaqpaaalfggawngtsl
sgsraalwysgpsfsfaffgargvcdhlil

Timeline for d2ioue2:

• d2ioue2 first appeared in SCOP 1.75
  
• d2ioue2 appears in SCOPe 2.07