![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.8: Mtd variable domain [143964] (1 protein) fold decorated with many additional structures; overall similarity to the Sulfatase modifying factor family; lacks the characteristic disulfide |
![]() | Protein Major tropism determinant (Mtd), C-terminal domain [143965] (1 species) |
![]() | Species Bordetella phage bpp-1 [TaxId:194699] [143966] (6 PDB entries) Uniprot Q775D6 171-380 includes related Bordetella phage proteins |
![]() | Domain d2ioud2: 2iou D:171-380 [147757] Other proteins in same PDB: d2ioua1, d2ioub1, d2iouc1, d2ioud1, d2ioue1, d2iouf1, d2ioug_, d2iouh_ automated match to d1yu2a2 complexed with mg |
PDB Entry: 2iou (more details), 3.16 Å
SCOPe Domain Sequences for d2ioud2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ioud2 d.169.1.8 (D:171-380) Major tropism determinant (Mtd), C-terminal domain {Bordetella phage bpp-1 [TaxId: 194699]} kfrpaaldprgmtlvagafwadiyllgvnhltdgtskynvtiadgsaspkkstkfggdgs aaysdgawynfaevmthhgkrlpnynefqalafgtteatssggtdvpttgvngtgatsaw niftskwgvvqasgclwtwgnefggvngaseytantggrgsvyaqpaaalfggawngtsl sgsraalwysgpsfsfaffgargvcdhlil
Timeline for d2ioud2: