Class b: All beta proteins [48724] (178 folds) |
Fold b.163: Pseudo beta-prism I [141657] (1 superfamily) beta-sandwich with one regular beta-sheet and the other beta-sheet bent in the middle with a set of aligned beta-bulges |
Superfamily b.163.1: Bacteriophage trimeric proteins domain [141658] (2 families) found in phage proteins that form trimers, but is not involved in the trimerisation |
Family b.163.1.1: Mtd domain-like [141659] (1 protein) |
Protein Major tropism determinant (Mtd), N-terminal domain [141660] (1 species) includes extra N-terminal trimerization domain; beta-alpha-beta(3) |
Species Bordetella phage bpp-1 [TaxId:194699] [141661] (6 PDB entries) Uniprot Q775D6 5-170 includes other related Bordetella phages |
Domain d2ioub1: 2iou B:5-170 [147752] Other proteins in same PDB: d2ioua2, d2ioub2, d2iouc2, d2ioud2, d2ioue2, d2iouf2, d2ioug_, d2iouh_ automated match to d1yu0a1 complexed with mg |
PDB Entry: 2iou (more details), 3.16 Å
SCOPe Domain Sequences for d2ioub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ioub1 b.163.1.1 (B:5-170) Major tropism determinant (Mtd), N-terminal domain {Bordetella phage bpp-1 [TaxId: 194699]} vqfrggttaqhatftgaareitvdtdkntvvvhdgataggfplarhdlvktafikadksa vaftrtgnatasikagtivevngklvqftadtaitmpaltagtdyaiyvcddgtvradsn fsaptgytsttarkvggfhyapgsnaaaqaggnttaqineyslwdi
Timeline for d2ioub1: