Lineage for d2iota1 (2iot A:16-245)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 802045Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 802046Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 802237Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins)
  6. 802553Protein Elastase [50536] (4 species)
  7. 802563Species Pig (Sus scrofa) [TaxId:9823] [50538] (94 PDB entries)
  8. 802590Domain d2iota1: 2iot A:16-245 [147749]
    automatically matched to d1c1ma_
    complexed with cl5, so4

Details for d2iota1

PDB Entry: 2iot (more details), 1.6 Å

PDB Description: Clavulanic Acid bound to Elastase
PDB Compounds: (A:) Elastase-1

SCOP Domain Sequences for d2iota1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2iota1 b.47.1.2 (A:16-245) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

SCOP Domain Coordinates for d2iota1:

Click to download the PDB-style file with coordinates for d2iota1.
(The format of our PDB-style files is described here.)

Timeline for d2iota1: