SCOPe 2.08: Domain d2iota_: 2iot A:

Lineage for d2iota_ (2iot A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)

6. Protein Elastase [50536] (4 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [50538] (123 PDB entries)

8. Domain d2iota_: 2iot A: [147749]
   automated match to d1c1ma_
   complexed with cl5, so4

Details for d2iota_

PDB Entry: 2iot, 1.6 Å

PDB Description: Clavulanic Acid bound to Elastase

PDB Compounds: (A:) Elastase-1

SCOPe Domain Sequences for d2iota_:

Sequence; same for both SEQRES and ATOM records:

>d2iota_ b.47.1.2 (A:) Elastase {Pig (Sus scrofa) [TaxId: 9823]}
vvggteaqrnswpsqislqyrsgsswahtcggtlirqnwvmtaahcvdreltfrvvvgeh
nlnqndgteqyvgvqkivvhpywntddvaagydiallrlaqsvtlnsyvqlgvlpragti
lannspcyitgwgltrtngqlaqtlqqaylptvdyaicssssywgstvknsmvcaggdgv
rsgcqgdsggplhclvngqyavhgvtsfvsrlgcnvtrkptvftrvsayiswinnviasn

Timeline for d2iota_:

• d2iota_ first appeared in SCOP 1.75, called d2iota1
  
• d2iota_ appears in SCOPe 2.07