SCOPe 2.08: Domain d2in5b_: 2in5 B:

Lineage for d2in5b_ (2in5 B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.177: YmcC-like [159269] (1 superfamily)
   12-stranded meander beta-sheet, folded into a deformed beta-barrel; topological similarity to the LolA-like fold (89391)

4. Superfamily b.177.1: YmcC-like [159270] (1 family)
   automatically mapped to Pfam PF11102

5. Family b.177.1.1: YmcC-like [159271] (1 protein)
   PfamB PB007600

6. Protein Hypothetical lipoprotein YmcC [159272] (1 species)

7. Species Escherichia coli [TaxId:562] [159273] (1 PDB entry)
   Uniprot P75884 17-214

8. Domain d2in5b_: 2in5 B: [147737]
   Other proteins in same PDB: d2in5a2
   automated match to d2in5a1

Details for d2in5b_

PDB Entry: 2in5, 2.3 Å

PDB Description: crystal structure of the hypothetical lipoprotein ymcc from escherichia coli (k12), northeast structural genomics target er552.

PDB Compounds: (B:) Hypothetical lipoprotein ymcC

SCOPe Domain Sequences for d2in5b_:

Sequence, based on SEQRES records:

>d2in5b_ b.177.1.1 (B:) Hypothetical lipoprotein YmcC {Escherichia coli [TaxId: 562]}
hsqqsmvdtfraslfdnqditvadqqiqalpystmylrlnegqrifvvlgyieqeqskwl
sqdnamlvthngrllktvklnnnllevtnsgqdplrnalaikdgsrwtrdilwsednhfr
satlsstfsfagletlniagrnvlcnvwqeevtstrpekqwqntfwvdsatgqvrqsrqm
lgagvipvemtflkpa

Sequence, based on observed residues (ATOM records):

>d2in5b_ b.177.1.1 (B:) Hypothetical lipoprotein YmcC {Escherichia coli [TaxId: 562]}
hsqqsmvdtfraslfdnqiqalpystmylrlnegqrifvvlgyieqeqskwlsqdnamlv
thngrllktvklnnnllevtnsgqdplrnalaikdgsrwtrdilwsednhfrsatlsstf
sfagletlniagrnvlcnvwqeevtstrpekqwqntfwvdsatgqvrqsrqmlgagvipv
emtflkpa

Timeline for d2in5b_:

• d2in5b_ first appeared in SCOP 1.75, called d2in5b1
  
• d2in5b_ appears in SCOPe 2.07