SCOP 1.75: Domain d2in5a1: 2in5 A:3-200

Lineage for d2in5a1 (2in5 A:3-200)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.177: YmcC-like [159269] (1 superfamily)
   12-stranded meander beta-sheet, folded into a deformed beta-barrel; topological similarity to the LolA-like fold ((89391))
   12-stranded meander beta-sheet, folded into a deformed beta-barrel; topological similarity to the LolA-like fold ((89391))

4. Superfamily b.177.1: YmcC-like [159270] (1 family)

5. Family b.177.1.1: YmcC-like [159271] (1 protein)
   PfamB PB007600

6. Protein Hypothetical lipoprotein YmcC [159272] (1 species)

7. Species Escherichia coli [TaxId:562] [159273] (1 PDB entry)
   Uniprot P75884 17-214

8. Domain d2in5a1: 2in5 A:3-200 [147736]

Details for d2in5a1

PDB Entry: 2in5, 2.3 Å

PDB Description: crystal structure of the hypothetical lipoprotein ymcc from escherichia coli (k12), northeast structural genomics target er552.

PDB Compounds: (A:) Hypothetical lipoprotein ymcC

SCOP Domain Sequences for d2in5a1:

Sequence, based on SEQRES records:

>d2in5a1 b.177.1.1 (A:3-200) Hypothetical lipoprotein YmcC {Escherichia coli [TaxId: 562]}
hsqqsmvdtfraslfdnqditvadqqiqalpystmylrlnegqrifvvlgyieqeqskwl
sqdnamlvthngrllktvklnnnllevtnsgqdplrnalaikdgsrwtrdilwsednhfr
satlsstfsfagletlniagrnvlcnvwqeevtstrpekqwqntfwvdsatgqvrqsrqm
lgagvipvemtflkpapl

Sequence, based on observed residues (ATOM records):

>d2in5a1 b.177.1.1 (A:3-200) Hypothetical lipoprotein YmcC {Escherichia coli [TaxId: 562]}
hsqqsmvdtfraslfdnqvadqqiqalpystmylrlnegqrifvvlgyieqeqskwlsqd
namlvthngrllktvklnnnllevtnsgqdplrnalaikdgsrwtrdilwsednhfrsat
lsstfsfagletlniagrnvlcnvwqeevtstrpekqwqntfwvdsatgqvrqsrqmlga
gvipvemtflkpapl

Timeline for d2in5a1:

• d2in5a1 is new in SCOP 1.75
  
• d2in5a1 appears in SCOPe 2.01
  
• d2in5a1 appears in the current release, SCOPe 2.08