![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) ![]() the beta-sheet barrel is similarly distorted and capped by a C-terminal helix has transition metal ions bound inside the barrel |
![]() | Family c.1.9.16: DR0824-like [159397] (1 protein) automatically mapped to Pfam PF01979 |
![]() | Protein Hypothetical protein DR0824 [159398] (1 species) predicted isoguanine deaminase/xanthine hydrolase |
![]() | Species Deinococcus radiodurans [TaxId:1299] [159399] (1 PDB entry) Uniprot Q9RW45 91-398 |
![]() | Domain d2imra2: 2imr A:91-398 [147735] Other proteins in same PDB: d2imra1 complexed with zn |
PDB Entry: 2imr (more details), 1.78 Å
SCOPe Domain Sequences for d2imra2:
Sequence, based on SEQRES records: (download)
>d2imra2 c.1.9.16 (A:91-398) Hypothetical protein DR0824 {Deinococcus radiodurans [TaxId: 1299]} pppvnahthldmsayefqalpyfqwipevvirgrhlrgvaaaqagadtltrlgaggvgdi vwapevmdallaredlsgtlyfevlnpfpdkadevfaaarthlerwrrlerpglrlglsp htpftvshrlmrllsdyaageglplqihvaehptelemfrtgggplwdnrmpalyphtla evigrepgpdltpvryldelgvlaarptlvhmvnvtpddiarvaragcavvtcprsnhhl ecgtfdwpafaaagvevalgtdsvasgetlnvreevtfarqlypgldprvlvraavkggq rvvggrtp
>d2imra2 c.1.9.16 (A:91-398) Hypothetical protein DR0824 {Deinococcus radiodurans [TaxId: 1299]} pppvnahthldmsayefqalpyfqwipevvirgrhlrgvaaaqagadtltrlgaggvgdi vwapevmdallaredlsgtlyfevlnpfpdkadevfaaarthlerwrrlerpglrlglsp htpftvshrlmrllsdyaageglplqihvaehptelemfrtgggplwdnrmpalyphtla evigrepgpdltpvryldelgvlaarptlvhmvnvtpddiarvaragcavvtcprsnhhl ecgtfdwpafaaagvevalgtdsvasgetlnvreevtfarqlypgldprvlvraavkggq rvvgtp
Timeline for d2imra2: