Lineage for d2imra2 (2imr A:91-398)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2084338Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. 2084904Family c.1.9.16: DR0824-like [159397] (1 protein)
    automatically mapped to Pfam PF01979
  6. 2084905Protein Hypothetical protein DR0824 [159398] (1 species)
    predicted isoguanine deaminase/xanthine hydrolase
  7. 2084906Species Deinococcus radiodurans [TaxId:1299] [159399] (1 PDB entry)
    Uniprot Q9RW45 91-398
  8. 2084907Domain d2imra2: 2imr A:91-398 [147735]
    Other proteins in same PDB: d2imra1
    complexed with zn

Details for d2imra2

PDB Entry: 2imr (more details), 1.78 Å

PDB Description: Crystal structure of amidohydrolase DR_0824 from Deinococcus radiodurans
PDB Compounds: (A:) Hypothetical protein DR_0824

SCOPe Domain Sequences for d2imra2:

Sequence, based on SEQRES records: (download)

>d2imra2 c.1.9.16 (A:91-398) Hypothetical protein DR0824 {Deinococcus radiodurans [TaxId: 1299]}
pppvnahthldmsayefqalpyfqwipevvirgrhlrgvaaaqagadtltrlgaggvgdi
vwapevmdallaredlsgtlyfevlnpfpdkadevfaaarthlerwrrlerpglrlglsp
htpftvshrlmrllsdyaageglplqihvaehptelemfrtgggplwdnrmpalyphtla
evigrepgpdltpvryldelgvlaarptlvhmvnvtpddiarvaragcavvtcprsnhhl
ecgtfdwpafaaagvevalgtdsvasgetlnvreevtfarqlypgldprvlvraavkggq
rvvggrtp

Sequence, based on observed residues (ATOM records): (download)

>d2imra2 c.1.9.16 (A:91-398) Hypothetical protein DR0824 {Deinococcus radiodurans [TaxId: 1299]}
pppvnahthldmsayefqalpyfqwipevvirgrhlrgvaaaqagadtltrlgaggvgdi
vwapevmdallaredlsgtlyfevlnpfpdkadevfaaarthlerwrrlerpglrlglsp
htpftvshrlmrllsdyaageglplqihvaehptelemfrtgggplwdnrmpalyphtla
evigrepgpdltpvryldelgvlaarptlvhmvnvtpddiarvaragcavvtcprsnhhl
ecgtfdwpafaaagvevalgtdsvasgetlnvreevtfarqlypgldprvlvraavkggq
rvvgtp

SCOPe Domain Coordinates for d2imra2:

Click to download the PDB-style file with coordinates for d2imra2.
(The format of our PDB-style files is described here.)

Timeline for d2imra2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2imra1