SCOPe 2.08: Domain d2imra1: 2imr A:34-90,A:399-418

Lineage for d2imra1 (2imr A:34-90,A:399-418)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.92: Composite domain of metallo-dependent hydrolases [51337] (1 superfamily)
   pseudobarrel; mixed sheet of 7 strand folded upon itself and "buckled" by two beta-turns

4. Superfamily b.92.1: Composite domain of metallo-dependent hydrolases [51338] (12 families)
   this domain is interrupted by the catalytic beta/alpha barrel domain

5. Family b.92.1.11: DR0824-like [159355] (1 protein)

6. Protein Hypothetical protein DR0824 [159356] (1 species)

7. Species Deinococcus radiodurans [TaxId:1299] [159357] (1 PDB entry)
   Uniprot Q9RW45 34-90,399-418

8. Domain d2imra1: 2imr A:34-90,A:399-418 [147734]
   Other proteins in same PDB: d2imra2
   complexed with zn

Details for d2imra1

PDB Entry: 2imr, 1.78 Å

PDB Description: crystal structure of amidohydrolase dr_0824 from deinococcus radiodurans

PDB Compounds: (A:) Hypothetical protein DR_0824

SCOPe Domain Sequences for d2imra1:

Sequence, based on SEQRES records:

>d2imra1 b.92.1.11 (A:34-90,A:399-418) Hypothetical protein DR0824 {Deinococcus radiodurans [TaxId: 1299]}
htprlltcdvlytgmggaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviaXfl
rrgetwqegfrwelsrdl

Sequence, based on observed residues (ATOM records):

>d2imra1 b.92.1.11 (A:34-90,A:399-418) Hypothetical protein DR0824 {Deinococcus radiodurans [TaxId: 1299]}
htprlltcdvlytgaqspggvvvvgetvaaaghpdelrrqyphaaeeragaviaXflrrg
etwqegfrwelsrdl

Timeline for d2imra1:

• d2imra1 first appeared in SCOP 1.75
  
• d2imra1 appears in SCOPe 2.07