Lineage for d2imqx_ (2imq X:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224399Fold d.151: DNase I-like [56218] (1 superfamily)
    contains beta-sandwich; duplication of alpha+beta motif
  4. 2224400Superfamily d.151.1: DNase I-like [56219] (4 families) (S)
  5. 2224474Family d.151.1.2: Inositol polyphosphate 5-phosphatase (IPP5) [64422] (3 proteins)
  6. 2224484Protein automated matches [190040] (1 species)
    not a true protein
  7. 2224485Species Bedbug (Cimex lectularius) [TaxId:79782] [186761] (7 PDB entries)
  8. 2224486Domain d2imqx_: 2imq X: [147733]
    automated match to d1ntfa_
    complexed with hem

Details for d2imqx_

PDB Entry: 2imq (more details), 1.3 Å

PDB Description: Crystal structure of ferrous cimex nitrophorin
PDB Compounds: (X:) Salivary nitrophorin

SCOPe Domain Sequences for d2imqx_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2imqx_ d.151.1.2 (X:) automated matches {Bedbug (Cimex lectularius) [TaxId: 79782]}
ppaqlsvhtvswnsgheraptnleellglnsgetpdviavavqgfgfqtdkpqqgpacvk
nfqslltskgytklkntitetmgltvyclekhldqntlknetiivtvddqkksggivtsf
tiynkrfsfttsrmsdedvtstntkyaydtrldyskkddpsdflfwigdlnvrvetnath
akslvdqnnidglmafdqlkkakeqklfdgwtepqvtfkptykfkpntdeydlsatpswt
dralyksgtgktiqplsynsltnykqtehrpvlakfrvtl

SCOPe Domain Coordinates for d2imqx_:

Click to download the PDB-style file with coordinates for d2imqx_.
(The format of our PDB-style files is described here.)

Timeline for d2imqx_: