SCOPe 2.03: Domain d2imqx_: 2imq X:

Lineage for d2imqx_ (2imq X:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.151: DNase I-like [56218] (1 superfamily)
   contains beta-sandwich; duplication of alpha+beta motif

4. Superfamily d.151.1: DNase I-like [56219] (4 families)

5. Family d.151.1.2: Inositol polyphosphate 5-phosphatase (IPP5) [64422] (3 proteins)

6. Protein automated matches [190040] (1 species)
   not a true protein

7. Species Bedbug (Cimex lectularius) [TaxId:79782] [186761] (3 PDB entries)

8. Domain d2imqx_: 2imq X: [147733]
   automated match to d1ntfa_
   complexed with hem

Details for d2imqx_

PDB Entry: 2imq, 1.3 Å

PDB Description: Crystal structure of ferrous cimex nitrophorin

PDB Compounds: (X:) Salivary nitrophorin

SCOPe Domain Sequences for d2imqx_:

Sequence; same for both SEQRES and ATOM records:

>d2imqx_ d.151.1.2 (X:) automated matches {Bedbug (Cimex lectularius) [TaxId: 79782]}
ppaqlsvhtvswnsgheraptnleellglnsgetpdviavavqgfgfqtdkpqqgpacvk
nfqslltskgytklkntitetmgltvyclekhldqntlknetiivtvddqkksggivtsf
tiynkrfsfttsrmsdedvtstntkyaydtrldyskkddpsdflfwigdlnvrvetnath
akslvdqnnidglmafdqlkkakeqklfdgwtepqvtfkptykfkpntdeydlsatpswt
dralyksgtgktiqplsynsltnykqtehrpvlakfrvtl

Timeline for d2imqx_:

• d2imqx_ first appeared in SCOP 1.75, called d2imqx1
  
• d2imqx_ appears in SCOPe 2.02
  
• d2imqx_ appears in SCOPe 2.04
  
• d2imqx_ appears in the current release, SCOPe 2.08