Lineage for d2imld2 (2iml D:2-191)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2063731Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2063732Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2063939Family b.45.1.4: MTH863-like [159164] (3 proteins)
    Pfam PF04289; DUF447; a new dimerisation mode involving (included) all-alpha subdomain of the spectrin-like fold (46965)
  6. 2063940Protein Hypothetical protein AF1834 [159165] (1 species)
  7. 2063941Species Archaeoglobus fulgidus [TaxId:2234] [159166] (1 PDB entry)
    Uniprot O28442 1-189
  8. 2063945Domain d2imld2: 2iml D:2-191 [147732]
    Other proteins in same PDB: d2imla2, d2imla3, d2imlb3, d2imlb4, d2imlc3, d2imlc4, d2imld3, d2imld4
    automated match to d2imla1
    complexed with fmn, gol

Details for d2imld2

PDB Entry: 2iml (more details), 1.65 Å

PDB Description: crystal structure of a hypothetical protein from archaeoglobus fulgidus binding riboflavin 5'-phosphate
PDB Compounds: (D:) hypothetical protein

SCOPe Domain Sequences for d2imld2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2imld2 b.45.1.4 (D:2-191) Hypothetical protein AF1834 {Archaeoglobus fulgidus [TaxId: 2234]}
rladfgftdgineiiaitenedgswnaapigiivedsssdtakaklyrnrtranlersgv
lfanvtddalvfavssfgnlnddwyaspnppiikgamawcrfeaemrsgvahlkltdgei
iekrvrainrglsaviealvhatryvaiksderrkellerihyyreivqkcgserekraf
eiimekigeg

SCOPe Domain Coordinates for d2imld2:

Click to download the PDB-style file with coordinates for d2imld2.
(The format of our PDB-style files is described here.)

Timeline for d2imld2: