SCOP 1.75: Domain d2imlb1: 2iml B:1-189

Lineage for d2imlb1 (2iml B:1-189)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.45: Split barrel-like [50474] (3 superfamilies)
   barrel; n=6, S=10; greek-key

4. Superfamily b.45.1: FMN-binding split barrel [50475] (4 families)
   related to the ferredoxin reductase-like FAD-binding domain

5. Family b.45.1.4: MTH863-like [159164] (3 proteins)
   Pfam PF04289; DUF447; a new dimerisation mode involving (included) all-alpha subdomain of the spectrin-like fold ((46965))

6. Protein Hypothetical protein AF1834 [159165] (1 species)

7. Species Archaeoglobus fulgidus [TaxId:2234] [159166] (1 PDB entry)
   Uniprot O28442 1-189

8. Domain d2imlb1: 2iml B:1-189 [147730]
   automatically matched to 2IML A:1-189
   complexed with fmn, gol

Details for d2imlb1

PDB Entry: 2iml, 1.65 Å

PDB Description: crystal structure of a hypothetical protein from archaeoglobus fulgidus binding riboflavin 5'-phosphate

PDB Compounds: (B:) hypothetical protein

SCOP Domain Sequences for d2imlb1:

Sequence; same for both SEQRES and ATOM records:

>d2imlb1 b.45.1.4 (B:1-189) Hypothetical protein AF1834 {Archaeoglobus fulgidus [TaxId: 2234]}
lrladfgftdgineiiaitenedgswnaapigiivedsssdtakaklyrnrtranlersg
vlfanvtddalvfavssfgnlnddwyaspnppiikgamawcrfeaemrsgvahlkltdge
iiekrvrainrglsaviealvhatryvaiksderrkellerihyyreivqkcgserekra
feiimekig

Timeline for d2imlb1:

• d2imlb1 is new in SCOP 1.75
  
• d2imlb1 is called d2imlb_ in SCOPe 2.01
  
• d2imlb1 appears in the current release, SCOPe 2.08, called d2imlb2